Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03129.1.g00010.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family VOZ
Protein Properties Length: 509aa    MW: 57133.6 Da    PI: 4.9313
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                             VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlye 171
                                     +elfdl ++ege+irewlffdkprraf+sgnrkqrslpdy grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlye 303 PELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYGGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYE 381
                                     8****************************************************************************** PP

                             VOZ 172 yeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                     yein++da+alyrle+k++d+kksak+k++++sl+++q++++rl+a 382 YEINDCDAFALYRLEFKSSDAKKSAKSKLACNSLNEIQQQMVRLSA 427
                                     ********************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012702007.10.0PREDICTED: transcription factor VOZ1
TrEMBLK3XG450.0K3XG45_SETIT; Uncharacterized protein
STRINGSi000864m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number